{"product_id":"proteintech-24584-1-ap","title":"Proteintech, 24584-1-AP, SLCO4C1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLCO4C1 (24584-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO4C1 in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n24584-1-AP targets SLCO4C1 in WB, IHC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, mouse kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20177 Product name: Recombinant human SLCO4C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC152989 Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 4C1\nCalculated Molecular Weight: 724 aa, 79 kDa\nObserved Molecular Weight: 60-85 kDa\nGenBank Accession Number: BC152989\nGene Symbol: SLCO4C1\nGene ID (NCBI): 353189\nRRID: AB_2879622\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZQN7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989149353,"sku":"24584-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24584-1-ap","provider":"Iright","version":"1.0","type":"link"}