{"product_id":"proteintech-24590-1-ap","title":"Proteintech, 24590-1-AP, Septin 14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Septin 14 (24590-1-AP) by Proteintech is a Polyclonal antibody targeting Septin 14 in WB, ELISA applications with reactivity to human,  mouse,  rat samples\n24590-1-AP targets Septin 14 in WB, IF, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20181 Product name: Recombinant human SEPT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 389-432 aa of BC153166 Sequence: IRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK Predict reactive species\nFull Name: septin 14\nCalculated Molecular Weight: 432 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC153166\nGene Symbol: Septin 14\nGene ID (NCBI): 346288\nRRID: AB_2879626\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZU15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869595488425,"sku":"24590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24590-1-ap","provider":"Iright","version":"1.0","type":"link"}