{"product_id":"proteintech-24599-1-ap","title":"Proteintech, 24599-1-AP, RAB3GAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB3GAP2 (24599-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3GAP2 in WB, ELISA applications with reactivity to human, mouse samples\n24599-1-AP targets RAB3GAP2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB3GAP2, also known as RAB3-GAP150, belongs to the Rab3-GAP regulatory subunit family. Rab3 GAP consists of two subunits: the catalytic subunit p130 and the noncatalytic subunit p150. Rab3 GAP is ubiquitously expressed and enriched in the synaptic soluble fraction of brain, consistent with it having a key role in neurodevelopment. RAB3-GAP150 forms the Rab3 GTPase-activating complex with RAB3-GAP130,where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. Defects in RAB3-GAP150 are the cause of Martsolf and Warburg Micro syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20254 Product name: Recombinant human RAB3GAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC146760 Sequence: MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPGVTEQ Predict reactive species\nFull Name: RAB3 GTPase activating protein subunit 2 (non-catalytic)\nCalculated Molecular Weight: 1393 aa, 156 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC146760\nGene Symbol: RAB3GAP2\nGene ID (NCBI): 25782\nRRID: AB_2879632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2M9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778353321,"sku":"24599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24599-1-ap","provider":"Iright","version":"1.0","type":"link"}