{"product_id":"proteintech-24622-1-ap","title":"Proteintech, 24622-1-AP, DcR1\/TNFRSF10C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DcR1\/TNFRSF10C (24622-1-AP) by Proteintech is a Polyclonal antibody targeting DcR1\/TNFRSF10C in WB, ELISA applications with reactivity to human samples\n24622-1-AP targets DcR1\/TNFRSF10C in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood leukocyte\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDecoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4\/TRAIL-R1 and DR5\/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and\/or unusual structural motifs (PMID: 9373179).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18399 Product name: Recombinant human TNFRSF10C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-259 aa of BC125041 Sequence: CRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain\nCalculated Molecular Weight: 259 aa, 27 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC125041\nGene Symbol: DcR1\nGene ID (NCBI): 8794\nRRID: AB_3085741\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887090585769,"sku":"24622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24622-1-ap","provider":"Iright","version":"1.0","type":"link"}