{"product_id":"proteintech-24624-1-ap","title":"Proteintech, 24624-1-AP, PHF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHF2 (24624-1-AP) by Proteintech is a Polyclonal antibody targeting PHF2 in WB, IP, IHC, ELISA applications with reactivity to human samples\n24624-1-AP targets PHF2 in WB, IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHD finger protein 2 (PHF2), also known as JHDM1E (Jumonji C domain-containing histone demethylase 1E) or GRC5, is a 1101 amino acid protein, which contains one JmjC domain and one PHD-type zinc finger. PHF2 belongs to the JHDM1 histone demethylase family and localizes in the nucleus. PHF2 demethylases both histones and non-histione proteins. PHF2 is widely expressed in various tissues and exists as two alternative splicing isoforms. The gene encoding PHF2 lies in the candidate region for hereditary sensory neuropathy type I (HSN1), a disorder characterized by sensory dysfunction\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20257 Product name: Recombinant human PHF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 445-780 aa of BC152437 Sequence: ASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATPPQSLLEKVSKKKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASPTIPNLDLLEAHTKEALTKMEPPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQASEEVGALEYN Predict reactive species\nFull Name: PHD finger protein 2\nCalculated Molecular Weight: 1101 aa, 121 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC152437\nGene Symbol: PHF2\nGene ID (NCBI): 5253\nRRID: AB_2879644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869728067753,"sku":"24624-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24624-1-ap","provider":"Iright","version":"1.0","type":"link"}