{"product_id":"proteintech-24626-1-ap","title":"Proteintech, 24626-1-AP, CEACAM7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEACAM7 (24626-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM7 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24626-1-AP targets CEACAM7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEACAM7, also known as CGM2, belongs to the carcinoembryonic antigen (CEA) family. CEACAM7 contains three domains: an N-terminal IgV domain, a single IgC2 domain, and a cell-surface GPI anchor domain. CEACAM7 achieves cell adhesion through dimerization of the N-terminal IgV domain. CEACAM7 is expressed on highly differentiated epithelial cells of the colon and rectum and on the epithelial cells within the ducts of the pancreas (PMID: 26323304). CEACAM7 has 2 isoforms with the molecular mass of 19 and 29 kDa. The observed MW of CEACAM7 is 58 kDa, which is consistent with the description in the literature (PMID: 36828119).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18579 Product name: Recombinant human CEACAM7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-213 aa of BC121132 Sequence: VTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGP Predict reactive species\nFull Name: carcinoembryonic antigen-related cell adhesion molecule 7\nCalculated Molecular Weight: 265 aa, 29 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC121132\nGene Symbol: CEACAM7\nGene ID (NCBI): 1087\nRRID: AB_3085742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14002\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886446497961,"sku":"24626-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24626-1-ap","provider":"Iright","version":"1.0","type":"link"}