{"product_id":"proteintech-24656-1-ap","title":"Proteintech, 24656-1-AP, SPINK5L3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPINK5L3 (24656-1-AP) by Proteintech is a Polyclonal antibody targeting SPINK5L3 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n24656-1-AP targets SPINK5L3 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPINK5L3 (Serine protease inhibitor Kazal-type 13) may be a serine protease inhibitor. It enables serine-type endopeptidase inhibitor activity, which is involved in the negative regulation of the acrosome reaction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19715 Product name: Recombinant human SPINK5L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-94 aa of BC128164 Sequence: KMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD Predict reactive species\nFull Name: serine PI Kazal type 5-like 3\nCalculated Molecular Weight: 94 aa, 11 kDa\nGenBank Accession Number: BC128164\nGene Symbol: SPINK5L3\nGene ID (NCBI): 153218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q1W4C9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814758569,"sku":"24656-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24656-1-ap","provider":"Iright","version":"1.0","type":"link"}