{"product_id":"proteintech-24676-1-ap","title":"Proteintech, 24676-1-AP, ATP13A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP13A5 (24676-1-AP) by Proteintech is a Polyclonal antibody targeting ATP13A5 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n24676-1-AP targets ATP13A5 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP13A5 is a member of the P5 subfamily of P-type transport ATPases. ATP13A5 functions within the intracellular membrane system and is mainly responsible for maintaining the ionic homeostasis and phospholipid balance of the intracellular membrane system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20337 Product name: Recombinant human ATP13A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1123-1218 aa of BC156652 Sequence: TQFCVAFFVEDSILQNHELWLLIKREFGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWARL Predict reactive species\nFull Name: ATPase type 13A5\nCalculated Molecular Weight: 1218 aa, 137 kDa\nGenBank Accession Number: BC156652\nGene Symbol: ATP13A5\nGene ID (NCBI): 344905\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4VNC0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885103337641,"sku":"24676-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24676-1-ap","provider":"Iright","version":"1.0","type":"link"}