{"product_id":"proteintech-24677-1-ap","title":"Proteintech, 24677-1-AP, SYNJ1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYNJ1 (24677-1-AP) by Proteintech is a Polyclonal antibody targeting SYNJ1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n24677-1-AP targets SYNJ1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, NIH\/3T3 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human brain tissue, human skeletal muscle tissue,  rat brain tissue,  rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptojanin 1, a polyphosphoinositide phosphatase, is expressed as two major alternatively spliced isoforms of 145 kDa (SJ145) and 170 kDa (SJ170), which are thought to have pleiotropic roles in endocytosis, signaling, and actin function. SJ145 is highly enriched in nerve terminals where it participates in clathrin-dependent synaptic vesicle recycling. SJ170, which differs from SJ145 by the presence of a carboxy-terminal extension, is the predominant isoform in developing neurons and is expressed in a variety of tissues (PMID:10801423).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20364 Product name: Recombinant human SYNJ1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 856-1125 aa of BC136603 Sequence: PVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRPAPPQRPPPPS Predict reactive species\nFull Name: synaptojanin 1\nCalculated Molecular Weight: 1612 aa, 178 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC136603\nGene Symbol: SYNJ1\nGene ID (NCBI): 8867\nRRID: AB_2879668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43426\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869434728617,"sku":"24677-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24677-1-ap","provider":"Iright","version":"1.0","type":"link"}