{"product_id":"proteintech-24697-1-ap","title":"Proteintech, 24697-1-AP, MN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MN1 (24697-1-AP) by Proteintech is a Polyclonal antibody targeting MN1 in WB, IHC, ELISA applications with reactivity to human samples\n24697-1-AP targets MN1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, U2OS cells\nPositive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMN1 (Transcriptional activator MN1), which is mainly located in nucleus. Highest expression is observed in fetal brain and skeletal muscle, and adult skeletal muscle. MN1 protein can interact with Brg1\/Brm related factor (BAF) complex containing Smarca4\/Brg1 and stabilize it on chromatin, thus maintaining the expression of hematopoietic progenitor cell-like genes. Under normal physiological conditions, MN1 protein is mainly expressed in granulocyte monocyte progenitor cells (GMP) in hematopoietic system, which plays an important role in the development and function of hematopoietic cells, and it is involved in regulating cell proliferation, differentiation, apoptosis and embryonic development. MN1 protein is related to many diseases, especially in leukemia (PMID: 23049943). MN1 gene rearrangements such as t(12; 22)(p13; Q11) can produce MN1-TEL fusion protein, which combines the transcriptional activation domain of MN1 and the DNA binding domain of TEL(ETV6), and can stably occupy the TEL recognition sequence, hindering the combination of normal transcription regulatory factors, thus leading to leukemia. Overexpression of MN1 gene has also been proved to be one of the signs of poor prognosis in patients with acute myeloid leukemia (AML), and its expression level is high in AML patients with normal karyotype. The molecular weight of MN1 is 136 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20344 Product name: Recombinant human MN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 978-1320 aa of BC156879 Sequence: QQQASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGDQPDLIGSLDGGAKSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQALVKASRSPLVTGSPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGGGGGPGHPGTPGLEQVRTPTSSSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGASGAQNGDSELGSCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT Predict reactive species\nFull Name: meningioma (disrupted in balanced translocation) 1\nCalculated Molecular Weight: 1320 aa, 136 kDa\nObserved Molecular Weight: 136 kDa\nGenBank Accession Number: BC156879\nGene Symbol: MN1\nGene ID (NCBI): 4330\nRRID: AB_2879678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q10571\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869004615849,"sku":"24697-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24697-1-ap","provider":"Iright","version":"1.0","type":"link"}