{"product_id":"proteintech-24704-1-ap","title":"Proteintech, 24704-1-AP, AWAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AWAT1 (24704-1-AP) by Proteintech is a Polyclonal antibody targeting AWAT1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24704-1-AP targets AWAT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, 3T3-L1 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAWAT1 is an ER-localized acyltransferase specialized for wax ester biosynthesis in sebaceous and meibomian glands. By esterifying long-chain fatty acyl-CoAs with fatty alcohols, AWAT1 generates crucial lipids that maintain skin barrier function, sebaceous secretion, and tear film stability. Dysregulation of AWAT1 contributes to meibomian gland dysfunction, dry eye disease, and sebaceous lipid imbalance, positioning AWAT1 as a key enzymatic regulator of surface lipid homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20183 Product name: Recombinant human AWAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-195 aa of BC153034 Sequence: LATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTL Predict reactive species\nFull Name: acyl-CoA wax alcohol acyltransferase 1\nCalculated Molecular Weight: 328 aa, 38 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC153034\nGene Symbol: AWAT1\nGene ID (NCBI): 158833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q58HT5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885159534761,"sku":"24704-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24704-1-ap","provider":"Iright","version":"1.0","type":"link"}