{"product_id":"proteintech-24743-1-ap","title":"Proteintech, 24743-1-AP, ACE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACE (24743-1-AP) by Proteintech is a Polyclonal antibody targeting ACE in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24743-1-AP targets ACE in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IHC detected in: rat lung tissue, human lung tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACE(Angiotensin-converting enzyme) is also named as DCP, DCP1 and belongs to the peptidase M2 family. It is involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE also has a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. It has 4 isoforms produced by alternative splicing. The full length protein has 15 glycosylation sites and it can show a molecular weight of 170 kDa(PMID:16804085).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20654 Product name: Recombinant human ACE protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 390-739 aa of BC036375 Sequence: FYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYMSKRAASSGPPGSPKLPPAAQGHGEVPVHDLLWHPGPPV Predict reactive species\nFull Name: angiotensin I converting enzyme (peptidyl-dipeptidase A) 1\nCalculated Molecular Weight: 150 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC036375\nGene Symbol: ACE\nGene ID (NCBI): 1636\nRRID: AB_2879701\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12821\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851097769,"sku":"24743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24743-1-ap","provider":"Iright","version":"1.0","type":"link"}