{"product_id":"proteintech-24755-1-ap","title":"Proteintech, 24755-1-AP, ZNF573 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF573 (24755-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF573 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24755-1-AP targets ZNF573 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF573 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF573 is involved in a broad range of biological functions including apoptosis, protein structure, DNA recognition, and RNA transcription, the structural variation in ZNF573 protein may result in the abnormal growth and development of human lens, further leading to the occurrence of cataracts.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20475 Product name: Recombinant human ZNF573 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-150 aa of BC042170 Sequence: PVVVDLLERGKEPWMILREETQFTDLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKKCQKKFSSGYQLILHHRFHVIERPYECKECGKN Predict reactive species\nFull Name: zinc finger protein 573\nCalculated Molecular Weight: 645 aa, 76 kDa\nGenBank Accession Number: BC042170\nGene Symbol: ZNF573\nGene ID (NCBI): 126231\nRRID: AB_3085753\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YE8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887950483625,"sku":"24755-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24755-1-ap","provider":"Iright","version":"1.0","type":"link"}