{"product_id":"proteintech-24771-1-ap","title":"Proteintech, 24771-1-AP, MATCHF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MATCHF1 (24771-1-AP) by Proteintech is a Polyclonal antibody targeting MATCHF1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n24771-1-AP targets MATCHF1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARCH1 is mainly found in secondary lymphoid organs, more specifically in the endocytic pathway of dendritic cells (DCs) and B cells (11-15). MARCH1 reduces the half-life of peptide\/MHC II complexes by causing their redistribution from recycling endosomes to lysosomes. MARCH1 homodimerizes and also forms heterodimers with others family members (PMID: 22508929).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20231 Product name: Recombinant human MARCH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 222-272 aa of BC153124 Sequence: QNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV Predict reactive species\nFull Name: membrane-associated ring finger (C3HC4) 1\nCalculated Molecular Weight: 289 aa, 32 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC153124\nGene Symbol: MARCHF1\nGene ID (NCBI): 55016\nRRID: AB_3085754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TCQ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887713996969,"sku":"24771-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24771-1-ap","provider":"Iright","version":"1.0","type":"link"}