{"product_id":"proteintech-24775-1-ap","title":"Proteintech, 24775-1-AP, SLC36A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC36A1 (24775-1-AP) by Proteintech is a Polyclonal antibody targeting SLC36A1 in WB, IHC, ELISA applications with reactivity to human samples\n24775-1-AP targets SLC36A1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20594 Product name: Recombinant human SLC36A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC136437 Sequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWF Predict reactive species\nFull Name: solute carrier family 36 (proton\/amino acid symporter), member 1\nCalculated Molecular Weight: 476 aa, 53 kDa\nObserved Molecular Weight: 43-53 kDa\nGenBank Accession Number: BC136437\nGene Symbol: SLC36A1\nGene ID (NCBI): 206358\nRRID: AB_2918086\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z2H8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989051049,"sku":"24775-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24775-1-ap","provider":"Iright","version":"1.0","type":"link"}