{"product_id":"proteintech-24803-1-ap","title":"Proteintech, 24803-1-AP, FAM92A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM92A1 (24803-1-AP) by Proteintech is a Polyclonal antibody targeting FAM92A1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n24803-1-AP targets FAM92A1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20738 Product name: Recombinant human FAM92A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-318 aa of BC014598 Sequence: ATLTARNREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQEAGWAATCQTLI Predict reactive species\nFull Name: family with sequence similarity 92, member A1\nCalculated Molecular Weight: 289 aa, 33 kDa\nObserved Molecular Weight: 29-33 kDa\nGenBank Accession Number: BC014598\nGene Symbol: FAM92A1\nGene ID (NCBI): 137392\nRRID: AB_2879735\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A1XBS5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980400297,"sku":"24803-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24803-1-ap","provider":"Iright","version":"1.0","type":"link"}