{"product_id":"proteintech-24807-1-ap","title":"Proteintech, 24807-1-AP, NPTXR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPTXR (24807-1-AP) by Proteintech is a Polyclonal antibody targeting NPTXR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24807-1-AP targets NPTXR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPTXR (Neuronal Pentraxin Receptor) is a type II transmembrane glycoprotein primarily expressed in the cerebellum and hippocampus. It mediates synaptic plasticity by clustering AMPA-type glutamate receptors at excitatory synapses and promoting synaptogenesis. NPTXR can be proteolytically cleaved to release a soluble form. Its dysregulation is implicated in Alzheimer's disease and small-cell lung cancer.(PMID: 9261167; 18367087; 19368810; 16115696)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20185 Product name: Recombinant human NPTXR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-296 aa of BC153027 Sequence: DSPALILELEDAVRALRDRIDRLEQELPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAELEHGSSAYSPPDAFKISIPIRNNYMYA Predict reactive species\nFull Name: neuronal pentraxin receptor\nCalculated Molecular Weight: 489 aa, 52 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC153027\nGene Symbol: NPTXR\nGene ID (NCBI): 23467\nRRID: AB_3085756\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95502\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887741587625,"sku":"24807-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24807-1-ap","provider":"Iright","version":"1.0","type":"link"}