{"product_id":"proteintech-24817-1-ap","title":"Proteintech, 24817-1-AP, USP50 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP50 (24817-1-AP) by Proteintech is a Polyclonal antibody targeting USP50 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24817-1-AP targets USP50 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: human hepatocirrhosis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin-specific protease 50 (USP50) belongs to the peptidase C19 family. USP50 has been shown to regulate cell cycle and DNA repair through interaction with the Wee1 protein in transformed human osteosarcoma and human epithelial cell lines. USP50 has also been shown to play a role in inflammasomal function by targeting the adaptor protein (PMID: 29101126). USP50 has 2 isoforms with the molecular mass of 38 and 39 kDa. Sometimes higher molecular weight around 44 kDa can also be observed, which may be a modified variant of USP50.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19337 Product name: Recombinant human USP50 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-339 aa of BC146493 Sequence: MTSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVEYFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA Predict reactive species\nFull Name: ubiquitin specific peptidase 50\nCalculated Molecular Weight: 339 aa, 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC146493\nGene Symbol: USP50\nGene ID (NCBI): 373509\nRRID: AB_2923574\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q70EL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869791637673,"sku":"24817-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24817-1-ap","provider":"Iright","version":"1.0","type":"link"}