{"product_id":"proteintech-24836-1-ap","title":"Proteintech, 24836-1-AP, BAIAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAIAP3 (24836-1-AP) by Proteintech is a Polyclonal antibody targeting BAIAP3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24836-1-AP targets BAIAP3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBai1 associated protein 3 (BAIAP3) is also named as BAP3 and KIAA0734, and belongs to the unc-13 family. It has the function of retrograde transport of endosomes to the Golgi apparatus. BAIAP3 may regulate behavior and food intake by controlling calcium-stimulated exocytosis of neurotransmitters including NPY and serotonin and hormones like insulin (PMID:286260000).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21219 Product name: Recombinant human BAIAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1056-1187 aa of BC104966 Sequence: PPHLFPLVRSQRTQVKTRTLHPVYDELFYFSVPAEACRRRAACVLFTVMDHDWLSTNDFAGEAALGLGGVTGVARPQVGGGARAGQPVTLHLCRPRAQVRSALRRLEGRTSKEAQEFVKKLKELEKCMEADP Predict reactive species\nFull Name: BAI1-associated protein 3\nCalculated Molecular Weight: 1187 aa, 132 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC104966\nGene Symbol: BAIAP3\nGene ID (NCBI): 8938\nRRID: AB_2879751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94812\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869517697193,"sku":"24836-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24836-1-ap","provider":"Iright","version":"1.0","type":"link"}