{"product_id":"proteintech-24883-1-ap","title":"Proteintech, 24883-1-AP, PLEKHO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHO1 (24883-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHO1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24883-1-AP targets PLEKHO1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEKHO1, also named as CK2 interacting protein 1 or OC120, is a 409 amino acid protein, which contains one PH domain. PLEKHO1 Predominantly localizes to the plasma membrane. PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). Catalog#24883-1-AP recognizes 46 kDa and 90 kDa homodimer band.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19309 Product name: Recombinant human PLEKHO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-409 aa of BC010149 Sequence: ASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM Predict reactive species\nFull Name: pleckstrin homology domain containing, family O member 1\nCalculated Molecular Weight: 409 aa, 46 kDa\nObserved Molecular Weight: 46 kDa, 90 kDa\nGenBank Accession Number: BC010149\nGene Symbol: PLEKHO1\nGene ID (NCBI): 51177\nRRID: AB_2879778\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53GL0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986790057,"sku":"24883-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24883-1-ap","provider":"Iright","version":"1.0","type":"link"}