{"product_id":"proteintech-24914-1-ap","title":"Proteintech, 24914-1-AP, INTU Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INTU (24914-1-AP) by Proteintech is a Polyclonal antibody targeting INTU in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24914-1-AP targets INTU in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  mouse heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINTU also named as KIAA1284, PDZD6, and PDZK6 is a 942 amino-acid protein, which belongs to the inturned family. INTU contains a PDZ domain and localizes in cytoplasm. Intu, a tissue-specific PCP effector gene, play a role in the context of skin and hair follicle development. Intu is expressed in both epidermal and dermal cells of the skin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19313 Product name: Recombinant human INTU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC130611 Sequence: MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDML Predict reactive species\nFull Name: inturned planar cell polarity effector homolog (Drosophila)\nCalculated Molecular Weight: 942 aa, 106 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC130611\nGene Symbol: INTU\nGene ID (NCBI): 27152\nRRID: AB_2879794\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULD6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887685783721,"sku":"24914-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24914-1-ap","provider":"Iright","version":"1.0","type":"link"}