{"product_id":"proteintech-24934-1-ap","title":"Proteintech, 24934-1-AP, ADAMTS12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAMTS12 (24934-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS12 in WB, IF\/ICC, ELISA applications with reactivity to human,  mouse samples\n24934-1-AP targets ADAMTS12 in WB, IF\/ICC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse placenta tissue,  NIH\/3T3 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAMTS12(A disintegrin and metalloproteinase with thrombospondin motifs 12) is also named as AT12, ADAM-TS12, PRO4389 and belongs to the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. ADAMTS7 and ADAMTS12 appear to be potent negative regulators of endplate cartilage development(PMID:22247065). This protein has 3 isoforms produced by alternative splicing. The full length protein has 14 glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20712 Product name: Recombinant human ADAMTS12 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-229 aa of BC058841 Sequence: MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW Predict reactive species\nFull Name: ADAM metallopeptidase with thrombospondin type 1 motif, 12\nCalculated Molecular Weight: 178 kDa\nObserved Molecular Weight: 155 kDa\nGenBank Accession Number: BC058841\nGene Symbol: ADAMTS12\nGene ID (NCBI): 81792\nRRID: AB_2879806\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868931674281,"sku":"24934-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24934-1-ap","provider":"Iright","version":"1.0","type":"link"}