{"product_id":"proteintech-24957-1-ap","title":"Proteintech, 24957-1-AP, C6orf182 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C6orf182 (24957-1-AP) by Proteintech is a Polyclonal antibody targeting C6orf182 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, monkey samples\n24957-1-AP targets C6orf182 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse kidney tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC6orf182 also named as Centrosomal protein of 57 kDa related protein is a 460 amino-acid protein, which belongs to translokin family. C6orf182 as centrosomal protein may be required for microtubule attachment to centrosomes and localizes in the cytoplasm. The function of C6orf182 need to be further studied.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21054 Product name: Recombinant human C6orf182 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC064365 Sequence: MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSPNSQALILALKTLQE Predict reactive species\nFull Name: chromosome 6 open reading frame 182\nCalculated Molecular Weight: 460 aa, 54 kDa\nObserved Molecular Weight: 55-65 kda\nGenBank Accession Number: BC064365\nGene Symbol: C6orf182\nGene ID (NCBI): 285753\nRRID: AB_2879821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYX8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869448327337,"sku":"24957-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24957-1-ap","provider":"Iright","version":"1.0","type":"link"}