{"product_id":"proteintech-24966-1-ap","title":"Proteintech, 24966-1-AP, PAQR7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAQR7 (24966-1-AP) by Proteintech is a Polyclonal antibody targeting PAQR7 in WB, ELISA applications with reactivity to human samples\n24966-1-AP targets PAQR7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProgestin and adipoQ receptor 7 (PAQR7), also called membrane P4 receptor α (mPRα), is a membrane protein with seven transmembrane domains, similar to G protein-coupled receptors (PMID: 34217103). Studies have shown that PAQR7 has important physiological functions in various reproductive tissues (PMID: 12601167). In addition, PAQR7 participates in the antimitotic action of P4 in human GCs and luteal cells, and P4's ability to suppress entry into the cell cycle was dependent on PAQR7 but not nuclear progesterone receptor (PGR) (PMID: 26203174).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21655 Product name: Recombinant human PAQR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC034015 Sequence: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQH Predict reactive species\nFull Name: progestin and adipoQ receptor family member VII\nCalculated Molecular Weight: 346 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC034015\nGene Symbol: PAQR7\nGene ID (NCBI): 164091\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86WK9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887750729897,"sku":"24966-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24966-1-ap","provider":"Iright","version":"1.0","type":"link"}