{"product_id":"proteintech-25021-1-ap","title":"Proteintech, 25021-1-AP, DEC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEC1 (25021-1-AP) by Proteintech is a Polyclonal antibody targeting DEC1 in IHC, ELISA applications with reactivity to human samples\n25021-1-AP targets DEC1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human prostate cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEC1 (Deleted in esophageal cancer 1), also named as CTS9 (Candidate tumor suppressor CTS9),is a tumor suppressor protein. It is expressed in many tissues, with highest expression in prostate and testis. This gene is different to another DEC1 protein (Differentially expressed in chondrocytes protein 1, BHLHE40).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20192 Product name: Recombinant human DEC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC153139 Sequence: MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD Predict reactive species\nFull Name: deleted in esophageal cancer 1\nCalculated Molecular Weight: 70 aa, 8 kDa\nGenBank Accession Number: BC153139\nGene Symbol: DEC1\nGene ID (NCBI): 50514\nRRID: AB_2879851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2X7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869673607337,"sku":"25021-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25021-1-ap","provider":"Iright","version":"1.0","type":"link"}