{"product_id":"proteintech-25040-1-ap","title":"Proteintech, 25040-1-AP, TPPP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPPP (25040-1-AP) by Proteintech is a Polyclonal antibody targeting TPPP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25040-1-AP targets TPPP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, MCF-7 cells,  rat brain tissue\nPositive IHC detected in: human brain tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19159 Product name: Recombinant human TPPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC131506 Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD Predict reactive species\nFull Name: tubulin polymerization promoting protein\nCalculated Molecular Weight: 219 aa, 24 kDa\nObserved Molecular Weight: 24-29 kDa\nGenBank Accession Number: BC131506\nGene Symbol: TPPP\nGene ID (NCBI): 11076\nRRID: AB_2879865\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94811\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817674409,"sku":"25040-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25040-1-ap","provider":"Iright","version":"1.0","type":"link"}