{"product_id":"proteintech-25043-1-ap","title":"Proteintech, 25043-1-AP, CAPZB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAPZB (25043-1-AP) by Proteintech is a Polyclonal antibody targeting CAPZB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25043-1-AP targets CAPZB in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse testis tissue,  HEK-293 cells,  HeLa cells,  Jurkat cells,  NIH\/3T3 cells,  mouse heart tissue,  rat heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human skin cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAPZB belongs to the F-actin-capping protein beta subunit family and is the β subunit of the heterodimeric F-actin cap-binding protein. F-actin-capping proteins bind in a Ca2+-independent manner to the fast-growing ends of actin filaments, thereby blocking the exchange of subunits at these ends.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19327 Product name: Recombinant human CAPZB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-243 aa of BC109241 Sequence: SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL Predict reactive species\nFull Name: capping protein (actin filament) muscle Z-line, beta\nCalculated Molecular Weight: 277 aa, 31 kDa\nObserved Molecular Weight: 30-31 kDa\nGenBank Accession Number: BC109241\nGene Symbol: CAPZB\nGene ID (NCBI): 832\nRRID: AB_2879867\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47756\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947894441,"sku":"25043-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25043-1-ap","provider":"Iright","version":"1.0","type":"link"}