{"product_id":"proteintech-25081-1-ap","title":"Proteintech, 25081-1-AP, PGP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGP (25081-1-AP) by Proteintech is a Polyclonal antibody targeting PGP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n25081-1-AP targets PGP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse heart tissue,  K-562 cells,  SH-SY5Y cells,  Y79 cells\nPositive IP detected in: Y79 cells\nPositive IHC detected in: mouse heart tissue, human skeletal muscle tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGP(phosphoglycolate phosphatase) belongs to the HAD-like hydrolase superfamily. It is an essential intermediate in the biosynthetic pathway of cardiolipin and a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. PGP catalyzes the formation of phosphatidylglycerol from phosphatidylglycerophosphate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18623 Product name: Recombinant human PGP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-321 aa of BC157035 Sequence: MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG Predict reactive species\nFull Name: phosphoglycolate phosphatase\nCalculated Molecular Weight: 321 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC157035\nGene Symbol: PGP\nGene ID (NCBI): 283871\nRRID: AB_2879888\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NDG6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913651881,"sku":"25081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25081-1-ap","provider":"Iright","version":"1.0","type":"link"}