{"product_id":"proteintech-25105-1-ap","title":"Proteintech, 25105-1-AP, NHE2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHE2 (25105-1-AP) by Proteintech is a Polyclonal antibody targeting NHE2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n25105-1-AP targets NHE2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat brain tissue,  mouse stomach tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHE2, also known as SLC9A2, is a protein-coding gene mainly at the top of gastrointestinal epithelial cells. It mainly encodes a member of the sodium-hydrogen exchanger (NHE) protein family, which is localized to the apical membrane and is easily degraded by lysosomes, resulting in a short half-life. NHE2 is involved in sodium ion transport by exchanging intracellular hydrogen ions into external sodium ions, and helps in the regulation of cell pH and volume to eliminate acids produced by active metabolism or against adverse environmental conditions. NHE2 is widely distributed in tissues of the gastrointestinal tract, kidney, heart, testes, uterus, and adrenal glands (PMID: 37688782). The observed molecular weight of NHE2 is 70 kDa, which might be the unmodified form of NHE2 (PMID: 10444453, 10666043).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18801 Product name: Recombinant human SLC9A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 686-812 aa of BC136377 Sequence: ISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSKDQSGSEREDSLTEGIPPKPPPRLVWRASEPGSRKARFGSEKP Predict reactive species\nFull Name: solute carrier family 9 (sodium\/hydrogen exchanger), member 2\nCalculated Molecular Weight: 812 aa, 92 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC136377\nGene Symbol: NHE2\/SLC9A2\nGene ID (NCBI): 6549\nRRID: AB_3085771\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBY0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887736705193,"sku":"25105-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25105-1-ap","provider":"Iright","version":"1.0","type":"link"}