{"product_id":"proteintech-25109-1-ap","title":"Proteintech, 25109-1-AP, MGAT4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MGAT4A (25109-1-AP) by Proteintech is a Polyclonal antibody targeting MGAT4A in WB, IHC, ELISA applications with reactivity to human samples\n25109-1-AP targets MGAT4A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMGAT4A (alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase A) is a key enzyme that catalyzes the formation of a specific branch on N-linked glycans (the transfer of β1,4-GlcNAc to the α1,3-mannose arm), belonging to the glycosyltransferase family. It is responsible for trimming and remodeling N-glycans in the Golgi apparatus to generate tissue- and disease-specific N-glycan structures. MGAT4A and MGAT4B are isoenzymes that catalyze the transfer of GlcNAc via a β1-4 linkage to the α1-3 linked mannose of the N-glycan core, thereby regulating glycoprotein maturation and function. This enzyme is involved in immunoglobulin G glycosylation, insulin receptor signaling, and neural cell adhesion molecule function. Deficiency of MGAT4A leads to decreased IgG galactosylation and enhanced pro-inflammatory activity, which is associated with an increased risk of autoimmune diseases such as rheumatoid arthritis and IgA nephropathy. Concurrently, it affects insulin secretion in pancreatic β-cells, highlighting its dual role in metabolic regulation and immune homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18956 Product name: Recombinant human MGAT4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 395-505 aa of BC127107 Sequence: EVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSL Predict reactive species\nFull Name: mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A\nCalculated Molecular Weight: 535 aa, 62 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC127107\nGene Symbol: MGAT4A\nGene ID (NCBI): 11320\nRRID: AB_2879901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UM21\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559476393,"sku":"25109-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25109-1-ap","provider":"Iright","version":"1.0","type":"link"}