{"product_id":"proteintech-25142-1-ap","title":"Proteintech, 25142-1-AP, HNRNPA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HNRNPA3 (25142-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPA3 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n25142-1-AP targets HNRNPA3 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  Jurkat cells\nPositive IHC detected in: human stomach tissue, human  colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse colon tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHNRNPA3 also named as hnRNP A3 or heterogeneous nuclear ribonucleoprotein A3 is a 378 amino acid protein, which contains 2 RRM domains and localizes in nucleus. HNRNPA3 is a component of the spliceosome C complex and play a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig, monkey, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18248 Product name: Recombinant human HNRNPA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-330 aa of BC113470 Sequence: MQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYN Predict reactive species\nFull Name: heterogeneous nuclear ribonucleoprotein A3\nCalculated Molecular Weight: 378 aa, 40 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC113470\nGene Symbol: HNRNPA3\nGene ID (NCBI): 220988\nRRID: AB_2879921\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51991\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879081641,"sku":"25142-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25142-1-ap","provider":"Iright","version":"1.0","type":"link"}