{"product_id":"proteintech-25190-1-ap","title":"Proteintech, 25190-1-AP, RSL24D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSL24D1 (25190-1-AP) by Proteintech is a Polyclonal antibody targeting RSL24D1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n25190-1-AP targets RSL24D1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HL-60 cells,  PC-3 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSL24D1 (Ribosomal L24 Domain Containing 1) is a ribosomal protein that is primarily localized in the nucleolus and is involved in the biogenesis of the 60S ribosomal subunit. In mouse embryonic stem cells (ESCs), the expression level of RSL24D1 is high and significantly decreases during cell differentiation. The role of RSL24D1 in ribosome biogenesis includes facilitating proper protein docking in nucleolar and cytoplasmic precursor particles. After the completion of biogenesis, RSL24D1 dissociates from the particles and is thought to be replaced by ribosomal protein L24.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18195 Product name: Recombinant human RSL24D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC008409 Sequence: MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP Predict reactive species\nFull Name: ribosomal L24 domain containing 1\nCalculated Molecular Weight: 163 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC008409\nGene Symbol: RSL24D1\nGene ID (NCBI): 51187\nRRID: AB_2879950\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHA3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009662121,"sku":"25190-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25190-1-ap","provider":"Iright","version":"1.0","type":"link"}