{"product_id":"proteintech-25196-1-ap","title":"Proteintech, 25196-1-AP, ZCCHC6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZCCHC6 (25196-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC6 in WB, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n25196-1-AP targets ZCCHC6 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, HEK-293T cells,  mouse brain tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZCCHC6 also named as KIAA1711 ,HS2 or TUT7 is a 1495 amino acid protein, which contains threes CCHC-type zinc fingers and two PAP-associated domains. A member of the DNA polymerase type-B-like family, ZCCHC6 as a uridylyltransferase that mediates RNA uridylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18240 Product name: Recombinant human ZCCHC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC032456 Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDV Predict reactive species\nFull Name: zinc finger, CCHC domain containing 6\nCalculated Molecular Weight: 1495 aa, 171 kDa\nObserved Molecular Weight: 171 kDa\nGenBank Accession Number: BC032456\nGene Symbol: ZCCHC6\nGene ID (NCBI): 79670\nRRID: AB_2879953\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VYS8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904706217,"sku":"25196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25196-1-ap","provider":"Iright","version":"1.0","type":"link"}