{"product_id":"proteintech-25202-1-ap","title":"Proteintech, 25202-1-AP, ANKRD33 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD33 (25202-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD33 in WB, IHC, ELISA applications with reactivity to human samples\n25202-1-AP targets ANKRD33 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnkyrin repeat domain 33 (ANKRD33), also named as C12orf7, belongs to the ankyrin repeat family and is highly expressed in retina. ANKRD33 exists as two isoforms. The isoform 1 molecular weight is 29kDa and isoform 2 is 49kDa. The function of ANKRD33 is still non-known.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18582 Product name: Recombinant human ANKRD33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-272 aa of BC121153 Sequence: AMRNRCECVATLLMAGADLTAVDPVRGKTALEWAVLTDSFDTVWRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQEGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLVPAEAQSFRTPKSGPSSLAIPGAQDREEETGGGGQNGTEVGEDGIGQAGNR Predict reactive species\nFull Name: ankyrin repeat domain 33\nCalculated Molecular Weight: 452 aa, 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC121153\nGene Symbol: ANKRD33\nGene ID (NCBI): 341405\nRRID: AB_2879956\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z3H0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970528937,"sku":"25202-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25202-1-ap","provider":"Iright","version":"1.0","type":"link"}