{"product_id":"proteintech-25212-1-ap","title":"Proteintech, 25212-1-AP, JIP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JIP3 (25212-1-AP) by Proteintech is a Polyclonal antibody targeting JIP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25212-1-AP targets JIP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19561 Product name: Recombinant human JIP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 171-248 aa of BC137123 Sequence: MIQTYVEHIERSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQLQSSSSYQ Predict reactive species\nFull Name: mitogen-activated protein kinase 8 interacting protein 3\nCalculated Molecular Weight: 1336 aa, 147 kDa\nObserved Molecular Weight: 147 kDa\nGenBank Accession Number: BC137123\nGene Symbol: JIP3\nGene ID (NCBI): 23162\nRRID: AB_2879962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869467988137,"sku":"25212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25212-1-ap","provider":"Iright","version":"1.0","type":"link"}