{"product_id":"proteintech-25214-1-ap","title":"Proteintech, 25214-1-AP, ZKSCAN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZKSCAN1 (25214-1-AP) by Proteintech is a Polyclonal antibody targeting ZKSCAN1 in WB, IF\/ICC, ELISA applications with reactivity to human,   mouse samples\n25214-1-AP targets ZKSCAN1 in WB, IF\/ICC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZKSCAN1(Zinc finger protein with KRAB and SCAN domains 1), also named as ZNF139, is a member in transcription factor zinc finger protein family(PMID: 24515389). Zinc finger protein 139 (ZNF139) gene is proved play an important role in gastric cancer, overexpression of ZNF139 correlated with tumor differentiation, invasion depth, clinical stage, lymphatic metastasis, and blood vessel invasion(PMID: 25436386, PMID: 25561801). The molecular weight of ZKSCAN1 is 64 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19721 Product name: Recombinant human ZKSCAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-382 aa of BC022378 Sequence: DLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDEC Predict reactive species\nFull Name: zinc finger with KRAB and SCAN domains 1\nCalculated Molecular Weight: 563 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC022378\nGene Symbol: ZKSCAN1\nGene ID (NCBI): 7586\nRRID: AB_2879963\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17029\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869795242153,"sku":"25214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25214-1-ap","provider":"Iright","version":"1.0","type":"link"}