{"product_id":"proteintech-25221-1-ap","title":"Proteintech, 25221-1-AP, BTN3A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTN3A1 (25221-1-AP) by Proteintech is a Polyclonal antibody targeting BTN3A1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n25221-1-AP targets BTN3A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells,  Jurkat cells\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBTN3A1, also named as Butyrophilin subfamily 3 member A1 or BTF5, is a 513 amino acid protein ,which contains one B30.2\/SPRY domain and two Ig-like V-type (immunoglobulin-like) domains. BTN3A1 localizes in the cell membrane and belongs to the immunoglobulin superfamily. BTN\/MOG family. BTN3A1 is detected on T-cells, natural killer cells, dendritic cells and macrophages. It is ubiquitously highly expressed in heart, pancreas and lung and moderately expressed in placenta, liver and muscle. BTN3A1 plays a role in T-cell activation and in the adaptive immune response. It also regulates the proliferation of activated T-cells and the release of cytokines and IFNG by activated T-cells. It exists as four isoforms. We detected a 48 kda isoform by western blot.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18414 Product name: Recombinant human BTN3A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 267-336 aa of BC121800 Sequence: GYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKAL Predict reactive species\nFull Name: butyrophilin, subfamily 3, member A1\nCalculated Molecular Weight: 513 aa, 58 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC121800\nGene Symbol: BTN3A1\nGene ID (NCBI): 11119\nRRID: AB_2879969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00481\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869396422825,"sku":"25221-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25221-1-ap","provider":"Iright","version":"1.0","type":"link"}