{"product_id":"proteintech-25244-1-ap","title":"Proteintech, 25244-1-AP, PHLPP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHLPP2 (25244-1-AP) by Proteintech is a Polyclonal antibody targeting PHLPP2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n25244-1-AP targets PHLPP2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHLPP2 also named as PHLPPL is a 1323 amino acid protein, which contains 22 LRR repeats, 1 PH domain and 1 PP2C-like domain. Localized to both the nucleus and the cytoplasm, PHLPPL uses manganese as a cofactor and mediates the dephosphorylation of Akt1, thereby playing a role in cell survival and apoptotic regulation. Multiple isoforms of PHLPPL exist due to alternative splicing events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19000 Product name: Recombinant human PHLPPL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 575-781 aa of BC129927 Sequence: LDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTS Predict reactive species\nFull Name: PH domain and leucine rich repeat protein phosphatase-like\nCalculated Molecular Weight: 1323 aa, 147 kDa\nObserved Molecular Weight: 147 kDa\nGenBank Accession Number: BC129927\nGene Symbol: PHLPPL\nGene ID (NCBI): 23035\nRRID: AB_2879985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZVD8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868886192297,"sku":"25244-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25244-1-ap","provider":"Iright","version":"1.0","type":"link"}