{"product_id":"proteintech-25287-1-ap","title":"Proteintech, 25287-1-AP, FER Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FER (25287-1-AP) by Proteintech is a Polyclonal antibody targeting FER in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human,   mouse samples\n25287-1-AP targets FER in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  A431 cells,  HeLa cells,  MCF-7 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human kidney tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFER(Tyrosine-protein kinase Fer) is also named as TYK3 and belongs to the protein kinase superfamily. Tyrosine-protein kinase acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. This protein has 3 isoforms produced by alternative promoter usage and alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18173 Product name: Recombinant human FER protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-445 aa of BC017060 Sequence: PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS Predict reactive species\nFull Name: fer (fps\/fes related) tyrosine kinase\nCalculated Molecular Weight: 822 aa, 95 kDa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: BC017060\nGene Symbol: FER\nGene ID (NCBI): 2241\nRRID: AB_2880009\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16591\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406318761,"sku":"25287-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25287-1-ap","provider":"Iright","version":"1.0","type":"link"}