{"product_id":"proteintech-25295-1-ap","title":"Proteintech, 25295-1-AP, PPFIA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPFIA4 (25295-1-AP) by Proteintech is a Polyclonal antibody targeting PPFIA4 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n25295-1-AP targets PPFIA4 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein tyrosine phosphatase receptor type F polypeptide interacting protein alpha 4 (PPFIA4), also named as Liprin alpha 4, belongs to the liprin family and Liprin-alpha subfamily. PPFIA4 has been reported as a new potential therapeutic target for refractory pancreatic cancer, small cell lung cancer, and clear cell renal cell cancer (PMID: 35382861).  As a glycolysis-related oncogene, PPFIA4 is also  a potential biomarker of colon cancer (PMID: 34094943).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18130 Product name: Recombinant human PPFIA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC132925 Sequence: MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4\nCalculated Molecular Weight: 701 aa, 78 kDa\nGenBank Accession Number: BC132925\nGene Symbol: PPFIA4\nGene ID (NCBI): 8497\nRRID: AB_3085783\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75335\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887769538729,"sku":"25295-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25295-1-ap","provider":"Iright","version":"1.0","type":"link"}