{"product_id":"proteintech-25326-1-ap","title":"Proteintech, 25326-1-AP, DYNC1LI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DYNC1LI1 (25326-1-AP) by Proteintech is a Polyclonal antibody targeting DYNC1LI1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25326-1-AP targets DYNC1LI1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HeLa cells,  Jurkat cells\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18191 Product name: Recombinant human DYNC1LI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-233 aa of BC131620 Sequence: SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT Predict reactive species\nFull Name: dynein, cytoplasmic 1, light intermediate chain 1\nCalculated Molecular Weight: 523 aa, 57 kDa\nObserved Molecular Weight: 57-60 kDa\nGenBank Accession Number: BC131620\nGene Symbol: DYNC1LI1\nGene ID (NCBI): 51143\nRRID: AB_2880031\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6G9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869677441193,"sku":"25326-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25326-1-ap","provider":"Iright","version":"1.0","type":"link"}