{"product_id":"proteintech-25350-1-ap","title":"Proteintech, 25350-1-AP, NOX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOX5 (25350-1-AP) by Proteintech is a Polyclonal antibody targeting NOX5 in WB, IHC, ELISA applications with reactivity to human samples\n25350-1-AP targets NOX5 in WB, IHC, CoIP, ELISA, PLA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Raji cells\nPositive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOX5 (NADPH oxidase, EF-hand calcium binding domain 5) is an NADPH oxidase that generates superoxide and functions as an H+ channel in a Ca(2+)-dependent manner. It plays an important role in PDGF-induced JAK\/STAT activation and human aortic smooth muscle cell (HASMC) proliferation. NOX5 is the main source of superoxide and is implicated in human spermatozoa motility. This protein has 6 isoforms produced by alternative splicing, named NOX5-α, -β, -γ, -δ, -ε and -ζ with the molecular mass of 84, 82, 86, 85, 64 and 83 kDa (PMID: 22427510 and Uniprot).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18673 Product name: Recombinant human NOX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 559-719 aa of BC125098 Sequence: YRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF Predict reactive species\nFull Name: NADPH oxidase, EF-hand calcium binding domain 5\nCalculated Molecular Weight: 765 aa, 86 kDa\nObserved Molecular Weight: 82-86 kDa\nGenBank Accession Number: BC125098\nGene Symbol: NOX5\nGene ID (NCBI): 79400\nRRID: AB_2811208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PH1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913422505,"sku":"25350-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25350-1-ap","provider":"Iright","version":"1.0","type":"link"}