{"product_id":"proteintech-25353-1-ap","title":"Proteintech, 25353-1-AP, TNRC4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNRC4 (25353-1-AP) by Proteintech is a Polyclonal antibody targeting TNRC4 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n25353-1-AP targets TNRC4 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  mouse spleen tissue\nPositive IHC detected in: human testis tissue,  human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNRC4, also named as BRUNOL1, CAGH4, ERDA4, or TNRC4, is a 465 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the CELF\/BRUNOL family. TNRC4 localizes in the nucleus and is expressed in brain. TNRC4 as a RNA-binding protein is involved in the regulation of pre-mRNA alternative splicing and mediates exon inclusion and\/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18601 Product name: Recombinant human TNRC4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 180-352 aa of BC052491 Sequence: GLRRMQQVATQLGMFSPITLQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSQVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVAQQ Predict reactive species\nFull Name: trinucleotide repeat containing 4\nCalculated Molecular Weight: 464 aa, 51 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC052491\nGene Symbol: TNRC4\nGene ID (NCBI): 11189\nRRID: AB_2880041\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5SZQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835009193,"sku":"25353-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25353-1-ap","provider":"Iright","version":"1.0","type":"link"}