{"product_id":"proteintech-25367-1-ap","title":"Proteintech, 25367-1-AP, HIGD1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HIGD1B (25367-1-AP) by Proteintech is a Polyclonal antibody targeting HIGD1B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n25367-1-AP targets HIGD1B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: rat heart tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHIG1 domain family member 1B (HIGD1B) is localized to the cell membrane whose expression is induced by hypoxia and glucose deprivation. HIG1 domain family member 1B (HIGD1B) is localized to the cell membrane whose expression is induced by hypoxia and glucose deprivation. (PMID: 34026765)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21871 Product name: Recombinant human HIGD1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-99 aa of BC020667 Sequence: MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQACAVGAIMLGAVYTMYSDYVKRMAQDAGEK Predict reactive species\nFull Name: HIG1 hypoxia inducible domain family, member 1B\nCalculated Molecular Weight: 99 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC020667\nGene Symbol: HIGD1B\nGene ID (NCBI): 51751\nRRID: AB_2880047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P298\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887667663017,"sku":"25367-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25367-1-ap","provider":"Iright","version":"1.0","type":"link"}