{"product_id":"proteintech-25371-1-ap","title":"Proteintech, 25371-1-AP, REM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REM2 (25371-1-AP) by Proteintech is a Polyclonal antibody targeting REM2 in WB, ELISA applications with reactivity to human, mouse samples\n25371-1-AP targets REM2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRem2 is a member of the RGK subfamily of RAS small GTPases. Rem2 inhibits high voltage activated calcium channels, is involved in synaptogenesis, and regulates dendritic morphology. Rem2 is the primary RGK protein expressed in the nervous system, but to date, the precise expression patterns of this protein are unknown.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21991 Product name: Recombinant human REM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC035663 Sequence: MDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLV Predict reactive species\nFull Name: RAS (RAD and GEM)-like GTP binding 2\nCalculated Molecular Weight: 340 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC035663\nGene Symbol: REM2\nGene ID (NCBI): 161253\nRRID: AB_2880049\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYK8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782449321,"sku":"25371-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25371-1-ap","provider":"Iright","version":"1.0","type":"link"}