{"product_id":"proteintech-25381-1-ap","title":"Proteintech, 25381-1-AP, NUP62CL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUP62CL (25381-1-AP) by Proteintech is a Polyclonal antibody targeting NUP62CL in WB, IHC, ELISA applications with reactivity to human samples\n25381-1-AP targets NUP62CL in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  Jurkat cells,  SH-SY5Y cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21107 Product name: Recombinant human NUP62CL protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-72 aa of BC017799 Sequence: MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVRFVFYMEK Predict reactive species\nFull Name: nucleoporin 62kDa C-terminal like\nCalculated Molecular Weight: 72 aa, 8 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC017799\nGene Symbol: NUP62CL\nGene ID (NCBI): 54830\nRRID: AB_2880051\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1M0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744438441,"sku":"25381-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25381-1-ap","provider":"Iright","version":"1.0","type":"link"}