{"product_id":"proteintech-25383-1-ap","title":"Proteintech, 25383-1-AP, MTF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTF1 (25383-1-AP) by Proteintech is a Polyclonal antibody targeting MTF1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25383-1-AP targets MTF1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  Jurkat cells,  mouse brain tissue,  mouse heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMetal regulatory transcription factor 1 (MTF1), contains six C2H2-type zinc finger and localizes in the nucleus. MTF1 is a 753 amino acid protein and calculated molecular weight is 81 kDa. We always dectected a 65-70 protein by western blot. MTF1 binds to the metal responsive element and activates the metallothionein I promoter.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, fish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21848 Product name: Recombinant human MTF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-753 aa of BC014454 Sequence: VSDVPPSTGNSASLSLPLVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK Predict reactive species\nFull Name: metal-regulatory transcription factor 1\nCalculated Molecular Weight: 753 aa, 81 kDa\nObserved Molecular Weight: 65-70 kDa, 100 kDa\nGenBank Accession Number: BC014454\nGene Symbol: MTF1\nGene ID (NCBI): 4520\nRRID: AB_2880053\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14872\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853260457,"sku":"25383-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25383-1-ap","provider":"Iright","version":"1.0","type":"link"}