{"product_id":"proteintech-25414-1-ap","title":"Proteintech, 25414-1-AP, AFF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AFF2 (25414-1-AP) by Proteintech is a Polyclonal antibody targeting AFF2 in WB, IP, ELISA applications with reactivity to human samples\n25414-1-AP targets AFF2 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive IP detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAFF2 (OMIM* 300806) (also known as FMR2 gene), which encodes AF4\/FMR2 family member 2, is a transcriptional factor and RNA-binding protein that plays an important role in transcriptional regulation, RNA splicing, mRNA processing, and nuclear speckle organization . AFF2 is highly conserved and abundantly expressed in human brain, being essential for brain development. Homozygous AFF2 knock-out mice showed abnormal central nervous system synaptic transmission, abnormal excitatory postsynaptic potential, and premature death (PMID: 35431806).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22225 Product name: Recombinant human AFF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-263 aa of BC132683 Sequence: LLTNHSNQNHLVGIPKNSVPQNPNNKNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKEDSNPNSSGEDAFKEIFQSNSPEESEFAVQAPGSPLVASSLLAPSSGLSV Predict reactive species\nFull Name: AF4\/FMR2 family, member 2\nCalculated Molecular Weight: 1311 aa, 145 kDa\nObserved Molecular Weight: 145 kDa\nGenBank Accession Number: BC132683\nGene Symbol: AFF2\nGene ID (NCBI): 2334\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51816\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869804548265,"sku":"25414-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25414-1-ap","provider":"Iright","version":"1.0","type":"link"}