{"product_id":"proteintech-25432-1-ap","title":"Proteintech, 25432-1-AP, BIVM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BIVM (25432-1-AP) by Proteintech is a Polyclonal antibody targeting BIVM in WB, IHC, ELISA applications with reactivity to human samples\n25432-1-AP targets BIVM in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBIVM has been identified using an electronic search based on the conservation of short sequence motifs within the variable region of immunoglobulin (Ig) genes. It is tightly linked (41 bp) and in the opposite transcriptional orientation to MGC5302 (also known as KDEL1 and EP58) in human. BIVM has two isoforms with MW 57 kDa and 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22087 Product name: Recombinant human BIVM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 411-503 aa of BC075084 Sequence: LHCIIAFQRLNWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWKKMSSIHERRNSGYQGYSDYDGND Predict reactive species\nFull Name: basic, immunoglobulin-like variable motif containing\nCalculated Molecular Weight: 503 aa, 57 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC075084\nGene Symbol: BIVM\nGene ID (NCBI): 54841\nRRID: AB_2880076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UB2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885239095465,"sku":"25432-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25432-1-ap","provider":"Iright","version":"1.0","type":"link"}