{"product_id":"proteintech-25443-1-ap","title":"Proteintech, 25443-1-AP, TTC35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTC35 (25443-1-AP) by Proteintech is a Polyclonal antibody targeting TTC35 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n25443-1-AP targets TTC35 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, human placenta tissue,  K-562 cells,  MCF-7 cells,  mouse heart tissue,  mouse spleen tissue,  NIH\/3T3 cells,  PC-3 cells,  SKOV-3 cells\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPR repeat protein 35 (TTC35), also named as tetratricopeptide repeat domain 35, is a 297 amino acid protein, which contains three TPR repeats and belongs to the EMC2 family. TTC35 localizes in the nucleus and cytoplasm. TTC35 is a component of the ER membrane protein complex and may be a putative O-linked glycosyl transferase.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22196 Product name: Recombinant human TTC35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-297 aa of BC021667 Sequence: MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS Predict reactive species\nFull Name: tetratricopeptide repeat domain 35\nCalculated Molecular Weight: 297 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC021667\nGene Symbol: TTC35\nGene ID (NCBI): 9694\nRRID: AB_2750836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15006\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899692713,"sku":"25443-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25443-1-ap","provider":"Iright","version":"1.0","type":"link"}